AboutAbout Serenity Mind and Body Solutions | MedSpa and Wellness Clinic Lakeland FL
MedSpa and Wellness Clinic Of Lakeland FL is a premier wellness clinic specializing in hormone replacement therapy and integrative health. Led by Oneida Cadavid, MSNA, APRN, CRNA—with over 24 years of experience—our team delivers personalized, root-cause–focused care. We offer customized HRT regimens, NAD⁺ therapy, peptide treatments, IV nutrient drips, GLP-1–based weight-loss programs, and lab testing. Utilizing advanced diagnostics and continuous monitoring, we craft individualized plans that balance hormones, boost energy, support immune function, and enhance vitality. We empower clients with education, support, and holistic care throughout their wellness journey for lasting results. Experience the Serenity difference today.
What patients mention most
From Google's review topics across 51 reviews.
Knowledgeable staff
23 reviews Welcoming atmosphere
18 reviews Ketamine therapy
11 reviews Personalized treatments
7 reviews Practice Overview
Location5143 S Lakeland Dr #2, Lakeland, FL 33813 ·
View map Business typeWellness center · Esthetics service · Medical spa · Mental health service · Weight loss service
Treatments offeredB12 shots, Botox, Cellulite Treatment at a Med Spa, Facials, Hormone therapy, IV therapy, Medical weight loss, NAD+ IV, Peptide Therapy, Rosacea Treatment at a Med Spa +2 more
PaymentCredit cards · Debit cards · Apple Pay / Google Pay
Treatment Prices
Serenity Mind and Body Solutions | MedSpa and Wellness Clinic Lakeland FL doesn't post prices online. Call (863) 900-2081 for a quote. ✎
Is this your practice?
Claim this free listing to add photos, keep prices current and get patient requests sent straight to you.
Treatments & Specialties
Good to knowAmenities & Accessibility
Service options
On-site servicesAccessibility
Wheelchair-accessible entranceAccessible parkingPayments
Credit cardsDebit cardsApple Pay / Google PayPatient reviewsWhat Patients Say
Location & hoursFind the Practice
Frequently asked questionsBefore You Book
What treatments does Serenity Mind and Body Solutions | MedSpa and Wellness Clinic Lakeland FL offer?
B12 shots, Botox, Cellulite Treatment at a Med Spa, Facials, Hormone therapy, IV therapy, Medical weight loss, NAD+ IV, and 4 more, based on their Google profile and website.
Is Serenity Mind and Body Solutions | MedSpa and Wellness Clinic Lakeland FL good?
It has a 5.0 rating from 51 Google reviews, and 51 of them are 5 stars.
Where is Serenity Mind and Body Solutions | MedSpa and Wellness Clinic Lakeland FL located?
5143 S Lakeland Dr #2, Lakeland, FL 33813.
Where this information comes from: the practice's Google Business Profile (rating, hours, categories, amenities), medspaandwellnesscliniclakelandfl.com (prices, team, devices, photos) and Google review topics. Last checked October 2026. This listing has not been claimed or verified by the practice.
Serenity Mind and Body Solutions | MedSpa and Wellness Clinic Lakeland FLMed spa · Lakeland, Florida
